× Aidez la recherche contre le COVID-19 avec votre ordi ! Rejoignez l'équipe PC Astuces Folding@home
 > Tous les forums > Forum Internet et Réseaux
 Adresse IP dans le code source d'un mail
Ajouter un message à la discussion
Page : [1] 
Page 1 sur 1
yo057
  Posté le 09/12/2019 @ 20:24 
Aller en bas de la page 
Astucien

tout le monde,

Je me demande un truc : dans le code source d'un mail réceptionné, puis-je identifier l'adresse IP d'envoi, et comment la localiser

j'avoue m'y perdre un peu, beaucoup en fait, ce mail n'est pas un spam, c'est pour comprendre,

merci pour vos lumière,

yo057

From - Mon Dec  9 18:21:02 2019
X-Account-Key: account1
X-UIDL: 1165118877.54842
X-Mozilla-Status: 0001
X-Mozilla-Status2: 00000000
X-Mozilla-Keys:                                                                                 
Return-Path: <xxx@wanadoo.fr>
Received: from mwinf5d14 (mwinf5c14 [10.223.111.64])
	 by mwinb2y01 with LMTPA;
	 Mon, 09 Dec 2019 18:20:49 +0100
X-Sieve: CMU Sieve 2.3
Received: from [192.168.1.16] ([78.207.104.56])
	by mwinf5d14 with ME
	id btLm210011D1SvA03tLm8c; Mon, 09 Dec 2019 18:20:49 +0100
X-ME-User-Auth: xxx@wanadoo.fr
X-bcc: xyz@wanadoo.fr
X-me-spamcause: (-100)(0000)gggruggvucftvghtrhhoucdtuddrgedufedrudeltddguddttdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfdpqfgfvfenuceurghilhhouhhtmecugedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepvffhuffkffgfgggtsehmtderredtfeejnecuhfhrohhmpeevrohlihhnvggprfhinhgthhgrrhhtqdeurghlohhhuceomhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrheqnecuffhomhgrihhnpehmlhdqmhgtrdhfrhdpfhgrtggvsghoohhkrdgtohhmnecukfhppeejkedrvddtjedruddtgedrheeinecurfgrrhgrmhephhgvlhhopegludelvddrudeikedruddrudeingdpihhnvghtpeejkedrvddtjedruddtgedrheeipdhmrghilhhfrhhomhepmhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrhdprhgtphhtthhopehmlhhmtgdrrggumhhinhhishhtrhgrthhifhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrkhgvnhiirgdrrghithdqohhurghrrggssehorhgrnhhgvgdrfhhrpdhrtghpthhtohepmhhlmhgtrdhmrghnuhgvlhdrfigvsggvrhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrlhgruhhrvghntggvrdgvghhlohhffhesfigrnhgrughoohdrfhhrpdhrtghpthhtohepmhhlmhgtqd
X-me-spamlevel: not-spam
X-ME-bounce-domain: wanadoo.fr
X-ME-Helo: [192.168.1.16]
X-ME-Auth: bWxtYy5jZWxpbmUucGluY2hhcnRAd2FuYWRvby5mcg==
X-ME-Date: Mon, 09 Dec 2019 18:20:49 +0100
X-ME-IP: 78.207.104.56
X-ME-Entity: ofr

Publicité
Hyportatif
 Posté le 09/12/2019 à 21:27 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Grand Maître astucien

Daneel Olivaw
 Posté le 09/12/2019 à 21:33 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien

yo057
 Posté le 10/12/2019 à 19:37 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
Astucien

,

Merci, je vais me plonger plus avant pour comprendre,

par contre, j'ai trouvé aussi ceci qui me semble plus réaliste

Qui croire ?

yo057

Daneel Olivaw
 Posté le 10/12/2019 à 19:49 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien

C'est l'adresse du FAI que tu vas de toute façon trouver, pas celle du client du FAI, qui n'est connue que du FAI.

Les adresse IP 78.192.0.0 à 78.255.255.255 appartiennent au même FAI qui qui a sa maison-mère à Paris. L'adresse IP 78.207.104.56 est en Bretagne.

Il n'y a pas de contradiction.

Page : [1] 
Page 1 sur 1

Vous devez être connecté pour poster des messages. Cliquez ici pour vous identifier.

Vous n'avez pas de compte ? Créez-en un gratuitement !


Les bons plans du moment PC Astuces

Tous les Bons Plans
969 €Microsoft Surface Laptop 3 13,5 pouces tactile (Core i5, 8 Go, SSD 128 Go) à 969 €
Valable jusqu'au 13 Avril

Amazon fait une promotion sur le tout récent ordinateur portable Microsoft Surface Laptop 3 13 pouces tactile qui passe à 969 € livré gratuitement alors qu'on le trouve ailleurs autour de 1150 €. Cet ordinateur de très grande qualité dispose d'un écran tactile de 13 pouces 2736x1824 pixels, de 8 Go de RAM, d'un processeur Intel Core i5 3470, d'un SSD de 128 Go (qui est facilement remplaçable si besoin). Il ne pèse que 1,2 kg et offre une autonomie jusqu'à 11h30.


> Voir l'offre
189,99 €Lot de 2 écrans 24 pouces Samsung S24F354 (Full HD, PLS, 4 ms, FreeSync) à 189,99 €
Valable jusqu'au 10 Avril

RueDuCommerce propose actuellement le lot de 2 écrans 24 pouces Samsung S24F354 à 189,99 € alors qu'on les trouve ailleurs à partir de 110 € l'unité. Ces écrans disposent d'une dalle PLS Full HD (1920x1080) et offrent un temps de réponse de 4 ms. Ils possèdent des entrées VGA et HDMI ainsi que des fonctions d'anti scintillement et anti lumière bleue.


> Voir l'offre
79,99 €Disque dur externe Western Digital My Passport 2 To + Clé USB 3.0 Sandisk 16 Go + Housse à 79,99 €
Valable jusqu'au 11 Avril

La Fnac fait une promotion sur un pack comprenant un disque dur externe Western Digital My Passport 2 To, un clé USB 3.0 Sandisk 16 Go ainsi qu'une housse à 79,99 € au lieu de 99,99 €.


> Voir l'offre

Sujets relatifs
Affichage adresse mail dans Outlook
insertion caractère spécial dans adresse mail
Coordonnées dans adresse mail
le sytème a détecté conflit adresse ip avec un autre systeme réseau
plusieurs carnets d'adresse dans boite mail orange
2ième adresse mail sur le même compte.
L'erreur 403 et le blocage d'adresse IP
Créer une adresse e-mail supplémentaire sur le même compte
supprimer une adresse mail dans cjoint
La suppression de mail dans THUNDERBIRD se fait mal dans le Webmail ORANGE
Plus de sujets relatifs à Adresse IP dans le code source d''un mail
 > Tous les forums > Forum Internet et Réseaux