> Tous les forums > Forum Internet et Réseaux
 Adresse IP dans le code source d'un mail
Ajouter un message à la discussion
Page : [1] 
Page 1 sur 1
yo057
  Posté le 09/12/2019 @ 20:24 
Aller en bas de la page 
Astucien

tout le monde,

Je me demande un truc : dans le code source d'un mail réceptionné, puis-je identifier l'adresse IP d'envoi, et comment la localiser

j'avoue m'y perdre un peu, beaucoup en fait, ce mail n'est pas un spam, c'est pour comprendre,

merci pour vos lumière,

yo057

From - Mon Dec  9 18:21:02 2019
X-Account-Key: account1
X-UIDL: 1165118877.54842
X-Mozilla-Status: 0001
X-Mozilla-Status2: 00000000
X-Mozilla-Keys:                                                                                 
Return-Path: <xxx@wanadoo.fr>
Received: from mwinf5d14 (mwinf5c14 [10.223.111.64])
	 by mwinb2y01 with LMTPA;
	 Mon, 09 Dec 2019 18:20:49 +0100
X-Sieve: CMU Sieve 2.3
Received: from [192.168.1.16] ([78.207.104.56])
	by mwinf5d14 with ME
	id btLm210011D1SvA03tLm8c; Mon, 09 Dec 2019 18:20:49 +0100
X-ME-User-Auth: xxx@wanadoo.fr
X-bcc: xyz@wanadoo.fr
X-me-spamcause: (-100)(0000)gggruggvucftvghtrhhoucdtuddrgedufedrudeltddguddttdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfdpqfgfvfenuceurghilhhouhhtmecugedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepvffhuffkffgfgggtsehmtderredtfeejnecuhfhrohhmpeevrohlihhnvggprfhinhgthhgrrhhtqdeurghlohhhuceomhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrheqnecuffhomhgrihhnpehmlhdqmhgtrdhfrhdpfhgrtggvsghoohhkrdgtohhmnecukfhppeejkedrvddtjedruddtgedrheeinecurfgrrhgrmhephhgvlhhopegludelvddrudeikedruddrudeingdpihhnvghtpeejkedrvddtjedruddtgedrheeipdhmrghilhhfrhhomhepmhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrhdprhgtphhtthhopehmlhhmtgdrrggumhhinhhishhtrhgrthhifhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrkhgvnhiirgdrrghithdqohhurghrrggssehorhgrnhhgvgdrfhhrpdhrtghpthhtohepmhhlmhgtrdhmrghnuhgvlhdrfigvsggvrhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrlhgruhhrvghntggvrdgvghhlohhffhesfigrnhgrughoohdrfhhrpdhrtghpthhtohepmhhlmhgtqd
X-me-spamlevel: not-spam
X-ME-bounce-domain: wanadoo.fr
X-ME-Helo: [192.168.1.16]
X-ME-Auth: bWxtYy5jZWxpbmUucGluY2hhcnRAd2FuYWRvby5mcg==
X-ME-Date: Mon, 09 Dec 2019 18:20:49 +0100
X-ME-IP: 78.207.104.56
X-ME-Entity: ofr

Publicité
Hyportatif
 Posté le 09/12/2019 à 21:27 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Grand Maître astucien

Daneel Olivaw
 Posté le 09/12/2019 à 21:33 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien
yo057
 Posté le 10/12/2019 à 19:37 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
Astucien

,

Merci, je vais me plonger plus avant pour comprendre,

par contre, j'ai trouvé aussi ceci qui me semble plus réaliste

Qui croire ?

yo057

Daneel Olivaw
 Posté le 10/12/2019 à 19:49 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien

C'est l'adresse du FAI que tu vas de toute façon trouver, pas celle du client du FAI, qui n'est connue que du FAI.

Les adresse IP 78.192.0.0 à 78.255.255.255 appartiennent au même FAI qui qui a sa maison-mère à Paris. L'adresse IP 78.207.104.56 est en Bretagne.

Il n'y a pas de contradiction.

Page : [1] 
Page 1 sur 1

Vous devez être connecté pour participer à la discussion.
Cliquez ici pour vous identifier.

Vous n'avez pas de compte ? Créez-en un gratuitement !
Recevoir PC Astuces par e-mail


La Lettre quotidienne +226 000 inscrits
Avec l'actu, des logiciels, des applis, des astuces, des bons plans, ...

Les bonnes affaires
Une fois par semaine, un récap des meilleurs offres.

Les fonds d'écran
De jolies photos pour personnaliser votre bureau. Une fois par semaine.

Les nouveaux Bons Plans
Des notifications pour ne pas rater les bons plans publiés sur le site.

Les bons plans du moment PC Astuces

Tous les Bons Plans
399 €Smartphone 6.67 pouces Xiaomi Mi 11i (5G, 256Go, 8Go) à 399 €
Valable jusqu'au 23 Janvier

Boulanger fait une superbe promotion sur le smartphone 6.67 pouces Xiaomi Mi 11i qui passe à 399 € au lieu de 499 €. Ce smartphone très bien équipé est compatible 5G, possède un processeur Snapdragon 888 à 8 coeurs, un écran FHD+ (2400x1080) à 120 Hz, 256 Go de stockage extensible par microSD, 8 Go de ram, 4 capteurs photos 108 mégapixels + 20 mégapixels + 8 mégapixels + 5 mégapixels et une caméra avant à 20 mégapixels. Le tout tourne sous Android 11.


> Voir l'offre
8,99 €Lot de 32 piles Philips AA à 8,99 €
Valable jusqu'au 25 Janvier

Fnac fait une promotion sur le lot de 32 piles Philips AA qui passe à 8,99 € au lieu de 15 €.


> Voir l'offre
796,84 €PC portable Dell Inspiron 14 2 en 1 (FHD tactile, Ryzen 7 5700U, 16Go/512Go, Windows 11) à 796,84 €
Valable jusqu'au 24 Janvier

Dell fait une promotion sur le PC portable 14 pouces Dell Inspiron 14 7415 qui passe à 796,84 € avec le code DLBINSP2 au lieu de 999 €. 

Ce portable possède un écran Full HD tactile que vous plier à 360° pour transformer l'ordinateur en tablette. Il a un processeur AMD Ryzen 7 5700U, 16 Go de RAM et un SSD M.2 NVMe de 512 Go. Le tout tourne sous Windows 11. Au niveau connectique, vous trouverez 2 x USB 3.1, 1xUSB 4.0 Type-C avec DisplayPort et Power Delivery, un port HDMI 1.4b, un lecteur microSD, le WiFi 6 et le bluetooth 5.1. Comptez une autonomie d'une dizaine d'heures. Une excelle affaire !

Pour profiter de l'offre, sélectionnez dans la liste le portable Inspiron 14 2 en 1 à 838,76 € avec la remise immédiate de 160 €. Utilisez le code DLBINSP2 dans votre panier pour passer le prix à 796,84 €.


> Voir l'offre

Sujets relatifs
Affichage adresse mail dans Outlook
insertion caractère spécial dans adresse mail
Coordonnées dans adresse mail
le sytème a détecté conflit adresse ip avec un autre systeme réseau
plusieurs carnets d'adresse dans boite mail orange
2ième adresse mail sur le même compte.
L'erreur 403 et le blocage d'adresse IP
Créer une adresse e-mail supplémentaire sur le même compte
supprimer une adresse mail dans cjoint
La suppression de mail dans THUNDERBIRD se fait mal dans le Webmail ORANGE
Plus de sujets relatifs à Adresse IP dans le code source d''un mail
 > Tous les forums > Forum Internet et Réseaux