× Aidez la recherche contre le COVID-19 avec votre ordi ! Rejoignez l'équipe PC Astuces Folding@home
 > Tous les forums > Forum Internet et Réseaux
 Adresse IP dans le code source d'un mail
Ajouter un message à la discussion
Page : [1] 
Page 1 sur 1
yo057
  Posté le 09/12/2019 @ 20:24 
Aller en bas de la page 
Astucien

tout le monde,

Je me demande un truc : dans le code source d'un mail réceptionné, puis-je identifier l'adresse IP d'envoi, et comment la localiser

j'avoue m'y perdre un peu, beaucoup en fait, ce mail n'est pas un spam, c'est pour comprendre,

merci pour vos lumière,

yo057

From - Mon Dec  9 18:21:02 2019
X-Account-Key: account1
X-UIDL: 1165118877.54842
X-Mozilla-Status: 0001
X-Mozilla-Status2: 00000000
X-Mozilla-Keys:                                                                                 
Return-Path: <xxx@wanadoo.fr>
Received: from mwinf5d14 (mwinf5c14 [10.223.111.64])
	 by mwinb2y01 with LMTPA;
	 Mon, 09 Dec 2019 18:20:49 +0100
X-Sieve: CMU Sieve 2.3
Received: from [192.168.1.16] ([78.207.104.56])
	by mwinf5d14 with ME
	id btLm210011D1SvA03tLm8c; Mon, 09 Dec 2019 18:20:49 +0100
X-ME-User-Auth: xxx@wanadoo.fr
X-bcc: xyz@wanadoo.fr
X-me-spamcause: (-100)(0000)gggruggvucftvghtrhhoucdtuddrgedufedrudeltddguddttdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfdpqfgfvfenuceurghilhhouhhtmecugedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepvffhuffkffgfgggtsehmtderredtfeejnecuhfhrohhmpeevrohlihhnvggprfhinhgthhgrrhhtqdeurghlohhhuceomhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrheqnecuffhomhgrihhnpehmlhdqmhgtrdhfrhdpfhgrtggvsghoohhkrdgtohhmnecukfhppeejkedrvddtjedruddtgedrheeinecurfgrrhgrmhephhgvlhhopegludelvddrudeikedruddrudeingdpihhnvghtpeejkedrvddtjedruddtgedrheeipdhmrghilhhfrhhomhepmhhlmhgtrdgtvghlihhnvgdrphhinhgthhgrrhhtseifrghnrgguohhordhfrhdprhgtphhtthhopehmlhhmtgdrrggumhhinhhishhtrhgrthhifhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrkhgvnhiirgdrrghithdqohhurghrrggssehorhgrnhhgvgdrfhhrpdhrtghpthhtohepmhhlmhgtrdhmrghnuhgvlhdrfigvsggvrhesohhrrghnghgvrdhfrhdprhgtphhtthhopehmlhhmtgdrlhgruhhrvghntggvrdgvghhlohhffhesfigrnhgrughoohdrfhhrpdhrtghpthhtohepmhhlmhgtqd
X-me-spamlevel: not-spam
X-ME-bounce-domain: wanadoo.fr
X-ME-Helo: [192.168.1.16]
X-ME-Auth: bWxtYy5jZWxpbmUucGluY2hhcnRAd2FuYWRvby5mcg==
X-ME-Date: Mon, 09 Dec 2019 18:20:49 +0100
X-ME-IP: 78.207.104.56
X-ME-Entity: ofr

Publicité
Hyportatif
 Posté le 09/12/2019 à 21:27 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Grand Maître astucien

Daneel Olivaw
 Posté le 09/12/2019 à 21:33 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien

yo057
 Posté le 10/12/2019 à 19:37 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
Astucien

,

Merci, je vais me plonger plus avant pour comprendre,

par contre, j'ai trouvé aussi ceci qui me semble plus réaliste

Qui croire ?

yo057

Daneel Olivaw
 Posté le 10/12/2019 à 19:49 
Aller en bas de la page Revenir au message précédent Revenir en haut de la page
  Maître astucien

C'est l'adresse du FAI que tu vas de toute façon trouver, pas celle du client du FAI, qui n'est connue que du FAI.

Les adresse IP 78.192.0.0 à 78.255.255.255 appartiennent au même FAI qui qui a sa maison-mère à Paris. L'adresse IP 78.207.104.56 est en Bretagne.

Il n'y a pas de contradiction.

Page : [1] 
Page 1 sur 1

Vous devez être connecté pour poster des messages. Cliquez ici pour vous identifier.

Vous n'avez pas de compte ? Créez-en un gratuitement !


Les bons plans du moment PC Astuces

Tous les Bons Plans
51,99 €SSD SanDisk Plus 480 Go à 51,99 €
Valable jusqu'au 27 Septembre

Amazon fait une promotion  sur le SSD SanDisk SSD Plus 480 Go à 51,99 € livré gratuitement alors qu'on le trouve actuellement autour de 80 € ailleurs. Une bonne affaire pour ce SSD performant qui offre des débits de 535 Mo/s en lecture et 445 Mo/s en écriture. Cette version est garantie 3 ans. 


> Voir l'offre
44,99 €SSD Kingston A400 480 Go à 44,99 €
Valable jusqu'au 26 Septembre

Amazon fait une promotion sur le SSD Kingston A400 480 Go qui passe à 44,99 € alors qu'on le trouve autour de 80 € ailleurs. Il offre des débits de 450 Mo/s en écriture et 500Mo/s en lecture. La livraison est gratuite.


> Voir l'offre
76,99 €Taille-haie sans-fil Tacklife GHT1B (lame 55 cm, 40V, Li-ion 2.5 Ah) à 76,99 € avec le code NRJUZO58
Valable jusqu'au 27 Septembre

Amazon fait une promotion sur le taille-haie sans-fil électrique Tacklife GHT1B avec sa batterie Li-ion 40V 2.5 Ah et son chargeur à 76,99 € avec le code promo NRJUZO58 au lieu de 109 €. Ce taille-haie offre une lame de coupe de 55 cm avec un espacement 20 mm entre les dents. La livraison est gratuite.


> Voir l'offre

Sujets relatifs
Affichage adresse mail dans Outlook
insertion caractère spécial dans adresse mail
Coordonnées dans adresse mail
le sytème a détecté conflit adresse ip avec un autre systeme réseau
plusieurs carnets d'adresse dans boite mail orange
2ième adresse mail sur le même compte.
L'erreur 403 et le blocage d'adresse IP
Créer une adresse e-mail supplémentaire sur le même compte
supprimer une adresse mail dans cjoint
La suppression de mail dans THUNDERBIRD se fait mal dans le Webmail ORANGE
Plus de sujets relatifs à Adresse IP dans le code source d''un mail
 > Tous les forums > Forum Internet et Réseaux